RPH3AL Peptide - middle region
RPH3AL Peptide - middle region
Product Specifications
Product Name Alternative
NOC2
UniProt
Q9UNE2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RPH3AL Rabbit Polyclonal Antibody (orb590047) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001177340.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: REPRSSETSRIYTWARGRVVSSDSDSDSDLSSSSLEDRLPSTGVRDRKGD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CD94 (KLRD1) Mouse Monoclonal Antibody [Clone ID: DX22]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fbb07/imageurl/am05552pu-l.webp)
AM05552PU-L 200 µg
CD94 (KLRD1) Mouse Monoclonal Antibody [Clone ID: DX22]
Sign In for Pricing
View Details ![CD56 (NCAM1) Mouse Monoclonal Antibody [Clone ID: SPM489]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd779/imageurl/am50146pu-s.webp)
AM50146PU-S 100 µg
CD56 (NCAM1) Mouse Monoclonal Antibody [Clone ID: SPM489]
Sign In for Pricing
View Details 
