Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WSB1 Peptide - middle region

WSB1 Peptide - middle region

Product Specifications

Product Name Alternative

SWIP1, WSB-1

UniProt

Q9Y6I7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WSB1 Rabbit Polyclonal Antibody (orb590049) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_056441.6

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PLOD1 Antibody Picoband®
A05322-1 100 µg/Vial

Anti-PLOD1 Antibody Picoband®

Sign In for Pricing
View Details
GH2 (NM_002059) Human Untagged Clone
SC324531 10 µg

GH2 (NM_002059) Human Untagged Clone

Sign In for Pricing
View Details
Hippeastrum hybrid (HHA) (FITC)
H4066-80F 1 mg

Hippeastrum hybrid (HHA) (FITC)

Sign In for Pricing
View Details
Sheep Olfactory receptor 52K1 (OR52K1) ELISA Kit
MBS7201878-01 48 Well

Sheep Olfactory receptor 52K1 (OR52K1) ELISA Kit

Sign In for Pricing
View Details
Sheep Olfactory receptor 52K1 (OR52K1) ELISA Kit
MBS7201878-02 96 Well

Sheep Olfactory receptor 52K1 (OR52K1) ELISA Kit

Sign In for Pricing
View Details
Sheep Olfactory receptor 52K1 (OR52K1) ELISA Kit
MBS7201878-03 5x 96 Well

Sheep Olfactory receptor 52K1 (OR52K1) ELISA Kit

Sign In for Pricing
View Details