Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WSB1 Peptide - middle region

WSB1 Peptide - middle region

Product Specifications

Product Name Alternative

SWIP1, WSB-1

UniProt

Q9Y6I7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WSB1 Rabbit Polyclonal Antibody (orb590049) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_056441.6

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Uroplakin-3a, UPK3A ELISA KIT
E6391Hu-01 48 Well

Human Uroplakin-3a, UPK3A ELISA KIT

Sign In for Pricing
View Details
Human Uroplakin-3a, UPK3A ELISA KIT
E6391Hu-02 96 Well

Human Uroplakin-3a, UPK3A ELISA KIT

Sign In for Pricing
View Details
Human Uroplakin-3a, UPK3A ELISA KIT
E6391Hu-03 5x 96 Tests

Human Uroplakin-3a, UPK3A ELISA KIT

Sign In for Pricing
View Details
Human Uroplakin-3a, UPK3A ELISA KIT
E6391Hu-04 10x 96 Tests

Human Uroplakin-3a, UPK3A ELISA KIT

Sign In for Pricing
View Details
Human Phosducin (PDC) ELISA Kit
QY-E03270 96 Tests

Human Phosducin (PDC) ELISA Kit

Sign In for Pricing
View Details
Camta2 3'UTR Luciferase Stable Cell Line
TU201619 1.0 mL

Camta2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details