Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOOK1 Peptide - middle region

HOOK1 Peptide - middle region

Product Specifications

Product Name Alternative

HK1

UniProt

Q9UJC3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOOK1 Rabbit Polyclonal Antibody (orb590053) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_056972.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKLDQLDGSFDDPNTVVAKKYFHAQLQLEQLQEENFRLEAAKDDYRVHCE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ttbk1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3004803 1.0 µg DNA

Ttbk1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Lipase member I (LIPI) Human ELISA Kit
E7022 96 Tests

Lipase member I (LIPI) Human ELISA Kit

Sign In for Pricing
View Details
FGF-23 siRNA (m)
sc-39487 10 µM

FGF-23 siRNA (m)

Sign In for Pricing
View Details
Lentiviral mouse Stxbp3 shRNA (UAS) - Lentiviral mouse Stxbp3 shRNA (UAS, RFP) (100)
GTR15303483 1 Vial

Lentiviral mouse Stxbp3 shRNA (UAS) - Lentiviral mouse Stxbp3 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
FANCG (Fanconi Anemia, Complementation Group G, FAG, XRCC9) (APC)
245968-APC 100 µL

FANCG (Fanconi Anemia, Complementation Group G, FAG, XRCC9) (APC)

Sign In for Pricing
View Details
Rabbit anti-TFEB Antibody, Affinity Purified
MBS3903923-01 0.01 mg

Rabbit anti-TFEB Antibody, Affinity Purified

Sign In for Pricing
View Details