Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOOK1 Peptide - middle region

HOOK1 Peptide - middle region

Product Specifications

Product Name Alternative

HK1

UniProt

Q9UJC3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOOK1 Rabbit Polyclonal Antibody (orb590053) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_056972.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKLDQLDGSFDDPNTVVAKKYFHAQLQLEQLQEENFRLEAAKDDYRVHCE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Irido virus
Oneq-V288-01 Oneq-V288-50D

Irido virus

Sign In for Pricing
View Details
Irido virus
Oneq-V288-02 Oneq-V288-100D

Irido virus

Sign In for Pricing
View Details
Irido virus
Oneq-V288-03 Oneq-V288-150D

Irido virus

Sign In for Pricing
View Details
NLRP3 (NM_001127462) Human Tagged ORF Clone
RG226287 10 µg

NLRP3 (NM_001127462) Human Tagged ORF Clone

Sign In for Pricing
View Details
CD306 Antibody
MBS8582784-01 0.1 mL

CD306 Antibody

Sign In for Pricing
View Details
CD306 Antibody
MBS8582784-02 0.1 mL (AF635)

CD306 Antibody

Sign In for Pricing
View Details