Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPN7 Peptide - middle region

PTPN7 Peptide - middle region

Product Specifications

Product Name Alternative

LPTP, HEPTP, PTPNI, BPTP-4, LC-PTP

UniProt

P35236

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTPN7 Rabbit Polyclonal Antibody (orb590055) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_542155.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ki-67 (Proliferating Cell Marker) (MKI67/2466), CF594 conjugate, 0.1mg/mL
BNC942466-100 1x 100 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2466), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cell Meter™ Live Cell Caspase 13 Binding Assay Kit *Green Fluorescence*
20125-AAT 25 Tests

Cell Meter™ Live Cell Caspase 13 Binding Assay Kit *Green Fluorescence*

Sign In for Pricing
View Details
SPDYE5 (N-term) Rabbit Polyclonal Antibody
AP54012PU-N 400 µL

SPDYE5 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Syrian Hamster IgG Isotype Control[SHG-1]
E-AB-F09763R-01 25 µg

Elab Fluor® Violet 500 Syrian Hamster IgG Isotype Control[SHG-1]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Syrian Hamster IgG Isotype Control[SHG-1]
E-AB-F09763R-02 100 µg

Elab Fluor® Violet 500 Syrian Hamster IgG Isotype Control[SHG-1]

Sign In for Pricing
View Details
PLET1 (NM_001145024) Human Over-expression Lysate
LC428648 20 µg

PLET1 (NM_001145024) Human Over-expression Lysate

Sign In for Pricing
View Details