Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPN7 Peptide - middle region

PTPN7 Peptide - middle region

Product Specifications

Product Name Alternative

LPTP, HEPTP, PTPNI, BPTP-4, LC-PTP

UniProt

P35236

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTPN7 Rabbit Polyclonal Antibody (orb590055) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_542155.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Protein Lysate, Stomach
CP565588 150 µg

Tissue Protein Lysate, Stomach

Sign In for Pricing
View Details
C16orf87 (NM_001001436) Human Over-expression Lysate
LC424354 20 µg

C16orf87 (NM_001001436) Human Over-expression Lysate

Sign In for Pricing
View Details
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), Biotin conjugate, 0.1mg/mL
BNCB2391-100 1x 100 µL

GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Her2 (ERBB2) pTyr1112 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 19G5]
AM00050PU-N 100 µg

Her2 (ERBB2) pTyr1112 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 19G5]

Sign In for Pricing
View Details
SMS Antibody
KC-333-01 50 μL

SMS Antibody

Sign In for Pricing
View Details
SMS Antibody
KC-333-02 100 µL

SMS Antibody

Sign In for Pricing
View Details