ARHGAP6 Peptide - C-terminal region
ARHGAP6 Peptide - C-terminal region
Product Specifications
Product Name Alternative
RHOGAP6, RHOGAPX-1
UniProt
O43182
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARHGAP6 Rabbit Polyclonal Antibody (orb55819) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_006116.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ARSEQYLTLSGAHDLSESELDVAGLQSRATPQCQRPHGSGRDDKRPPPPY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680994-500 1x 500 µL
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 