Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP4E1 Peptide - middle region

AP4E1 Peptide - middle region

Product Specifications

Product Name Alternative

CPSQ4, SPG51

UniProt

Q9UPM8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AP4E1 Rabbit Polyclonal Antibody (orb590205) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001239056.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CSSFSSLSNVAYEDDYYSNTLHDTGDKELKKFSLTSELLDSESLTELPLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS638442 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
PNPLA1 (NM_001145717) Human Over-expression Lysate
LC428981 20 µg

PNPLA1 (NM_001145717) Human Over-expression Lysate

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (N/A), CF647 conjugate, 0.1mg/mL
BNC471826-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (N/A), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), CF488A conjugate, 0.1mg/mL
BNC881758-100 1x 100 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BEX4 (NM_001080425) Human Recombinant Protein
TP313659M 100 µg

BEX4 (NM_001080425) Human Recombinant Protein

Sign In for Pricing
View Details
C12orf43 (NM_022895) Human Recombinant Protein
TP304834M 100 µg

C12orf43 (NM_022895) Human Recombinant Protein

Sign In for Pricing
View Details