Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP4E1 Peptide - middle region

AP4E1 Peptide - middle region

Product Specifications

Product Name Alternative

CPSQ4, SPG51

UniProt

Q9UPM8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AP4E1 Rabbit Polyclonal Antibody (orb590205) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001239056.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CSSFSSLSNVAYEDDYYSNTLHDTGDKELKKFSLTSELLDSESLTELPLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMP1 (Colorectal and Lymph Node Metastasis Marker) (TIMP1/1944R), 0.2mg/mL
BNUB1944-100 1x 100 µL

TIMP1 (Colorectal and Lymph Node Metastasis Marker) (TIMP1/1944R), 0.2mg/mL

Sign In for Pricing
View Details
Euscaphic Acid
TRC-E939500-5MG 5 mg

Euscaphic Acid

Sign In for Pricing
View Details
macroH2A.1 Rabbit Polyclonal Antibody
ER1803-04 100 µL

macroH2A.1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Bnip3l activation kit by CRISPRa
GA200433 1 Kit

Mouse Bnip3l activation kit by CRISPRa

Sign In for Pricing
View Details
4,4'-(Ethyne-1,2-Diyl)Dibenzoic Acid
TRC-E941418-50MG 50 mg

4,4'-(Ethyne-1,2-Diyl)Dibenzoic Acid

Sign In for Pricing
View Details
Slc23a3 Mouse Gene Knockout Kit (CRISPR)
KN515948 1 Kit

Slc23a3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details