Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PON2 Peptide - middle region

PON2 Peptide - middle region

Product Specifications

UniProt

Q15165

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PON2 Rabbit Polyclonal Antibody (orb589405) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000296.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDTLVDNLSIDPSSGDIWVGCHPNGQKLFVYDPNNPPSSEVLRIQNILCE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human uridine phosphorylase 1,UPP1 ELISA KIT
JOT-EK0819Hu-01 96 Well

Human uridine phosphorylase 1,UPP1 ELISA KIT

Sign In for Pricing
View Details
Human uridine phosphorylase 1,UPP1 ELISA KIT
JOT-EK0819Hu-02 48 Well

Human uridine phosphorylase 1,UPP1 ELISA KIT

Sign In for Pricing
View Details
BCLAF1 (M33-P5B11) Alexa Fluor® 546
sc-101388 AF546 200 µg/mL

BCLAF1 (M33-P5B11) Alexa Fluor® 546

Sign In for Pricing
View Details
Mouse Anti-Monkey IgG (H&L) - Alexa Fluor 555
E38A3440 100 µL

Mouse Anti-Monkey IgG (H&L) - Alexa Fluor 555

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain SE11) RSXA Polyclonal Antibody
MBS7171739 Inquire

Rabbit anti-Escherichia coli (strain SE11) RSXA Polyclonal Antibody

Sign In for Pricing
View Details
AVSD1 3'UTR GFP Stable Cell Line
TU051547 1.0 mL

AVSD1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details