Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PON2 Peptide - middle region

PON2 Peptide - middle region

Product Specifications

UniProt

Q15165

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PON2 Rabbit Polyclonal Antibody (orb589405) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000296.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDTLVDNLSIDPSSGDIWVGCHPNGQKLFVYDPNNPPSSEVLRIQNILCE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTAGE5 (MIA2) (NM_203356) Human Tagged ORF Clone
RG218068 10 µg

CTAGE5 (MIA2) (NM_203356) Human Tagged ORF Clone

Sign In for Pricing
View Details
SNX7 Polyclonal Antibody
E97805 100 µL

SNX7 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CD158j/KIR2DS2 Protein, N-GST
orb2830954-01 20 µg

Recombinant Human CD158j/KIR2DS2 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human CD158j/KIR2DS2 Protein, N-GST
orb2830954-02 50 µg

Recombinant Human CD158j/KIR2DS2 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human CD158j/KIR2DS2 Protein, N-GST
orb2830954-03 100 µg

Recombinant Human CD158j/KIR2DS2 Protein, N-GST

Sign In for Pricing
View Details
PCMV-RCVRN-P2A-mCherry-Neo Plasmid
PVT66719 2 µg

PCMV-RCVRN-P2A-mCherry-Neo Plasmid

Sign In for Pricing
View Details