LRIF1 Peptide - C-terminal region
LRIF1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
RIF1, HBiX1, C1orf103
UniProt
Q5T3J3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LRIF1 Rabbit Polyclonal Antibody (orb589417) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001006946.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EKQEKGTLNSNAAYEQSHFFNKNYTEDIFPVTPPELEETIRDEKIRRLKQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041176-100 1x 100 µL
EMI1 (EMI1/1176), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details