GNPDA2 Peptide - middle region
GNPDA2 Peptide - middle region
Product Specifications
Product Name Alternative
GNP2, SB52
UniProt
Q8TDQ7
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GNPDA2 Rabbit Polyclonal Antibody (orb589425) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001257809.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15373483 1 Vial
Lentiviral human AFF2 sgRNA gene knockout kit - Lentiviral human AFF2 sgRNA gene knockout kit (100)
Sign In for Pricing
View Details 