MR1 Peptide - middle region
MR1 Peptide - middle region
Product Specifications
Product Name Alternative
HLALS
UniProt
Q95460
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MR1 Rabbit Polyclonal Antibody (orb589647) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001181928.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb3107119 100 µg
BAP31/BCAP31 Rabbit Polyclonal Antibody (Fluoro647)
Sign In for Pricing
View Details 
bs-5234R-PerCP-Cy5.5 100 µL
Phospho-Bcl-xL (Thr115) Polyclonal Antibody, PerCP-Cy5.5 Conjugated
Sign In for Pricing
View Details 
MBS8421956-01 0.12 mL
Rabbit Anti Human NEUROG3 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)
Sign In for Pricing
View Details MBS8421956-02 0.2 mL
Rabbit Anti Human NEUROG3 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)
Sign In for Pricing
View Details MBS8421956-03 5x 0.2 mL
Rabbit Anti Human NEUROG3 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)
Sign In for Pricing
View Details