Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MR1 Peptide - middle region

MR1 Peptide - middle region

Product Specifications

Product Name Alternative

HLALS

UniProt

Q95460

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MR1 Rabbit Polyclonal Antibody (orb589647) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001181928.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPNS1L2 (SIRPD) (NM_178460) Human Untagged Clone
SC123357 10 µg

PTPNS1L2 (SIRPD) (NM_178460) Human Untagged Clone

Sign In for Pricing
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) OSA Polyclonal Antibody
MBS9001902 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) OSA Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Dihydrofolate Reductase/DHFR Antibody (OTI6G7) [Alexa Fluor 700]
NBP2-70569AF700 0.1 mL

Mouse Monoclonal Dihydrofolate Reductase/DHFR Antibody (OTI6G7) [Alexa Fluor 700]

Sign In for Pricing
View Details
FITC anti-human CD2
GT06646 100 Tests

FITC anti-human CD2

Sign In for Pricing
View Details
TAK1 Rabbit mAb
C05165-100ul 100 µL

TAK1 Rabbit mAb

Sign In for Pricing
View Details
Rabbit Polyclonal RUNDC3B Antibody
NBP2-31654-25ul 25 µL

Rabbit Polyclonal RUNDC3B Antibody

Sign In for Pricing
View Details