Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNJ2 Peptide - C-terminal region

KCNJ2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IRK1, LQT7, SQT3, ATFB9, HHIRK1, KIR2.1, HHBIRK1

UniProt

P63252

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNJ2 Rabbit Polyclonal Antibody (orb589648) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000882.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRPLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCR3 (NM_001164680) Human Over-expression Lysate
LY431329 100 µg

CCR3 (NM_001164680) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Myosin Heavy Chain 2, Skeletal Muscle, Adult (MYH2) ELISA Kit
RDR-MYH2-Mu-01 96 Tests

Mouse Myosin Heavy Chain 2, Skeletal Muscle, Adult (MYH2) ELISA Kit

Sign In for Pricing
View Details
Mouse Myosin Heavy Chain 2, Skeletal Muscle, Adult (MYH2) ELISA Kit
RDR-MYH2-Mu-02 48 Tests

Mouse Myosin Heavy Chain 2, Skeletal Muscle, Adult (MYH2) ELISA Kit

Sign In for Pricing
View Details
α, ω-Bis-Bromo PEG
116000-1.5G 5 g

α, ω-Bis-Bromo PEG

Sign In for Pricing
View Details
GRP94 Antibody
KC-2720-01 50 μL

GRP94 Antibody

Sign In for Pricing
View Details
GRP94 Antibody
KC-2720-02 100 µL

GRP94 Antibody

Sign In for Pricing
View Details