Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKAP12 Peptide - middle region

AKAP12 Peptide - middle region

Product Specifications

Product Name Alternative

SSeCKS, AKAP250

UniProt

Q02952

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AKAP12 Rabbit Polyclonal Antibody (orb589716) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005091.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLSSQERMKVQGSPLKKLFTSTGLKKLSGKKQKGKRGGGDEESGEHTQVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycidyl Docosahexaenoate
TRC-G615600-10MG 10 mg

Glycidyl Docosahexaenoate

Sign In for Pricing
View Details
Mitochondrial Marker (MTC02), CF647 conjugate, 0.1mg/mL
BNC470740-100 1x 100 µL

Mitochondrial Marker (MTC02), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AP1S3 (NM_001039569) Human Over-expression Lysate
LC422072 20 µg

AP1S3 (NM_001039569) Human Over-expression Lysate

Sign In for Pricing
View Details
N-Cyclohexylbenzo[d]thiazole-2-sulfonamide
TRC-C992305-250MG 250 mg

N-Cyclohexylbenzo[d]thiazole-2-sulfonamide

Sign In for Pricing
View Details
Beta,4-Dihydroxybenzenepropanoic Acid
TRC-D679020-25MG 25 mg

Beta,4-Dihydroxybenzenepropanoic Acid

Sign In for Pricing
View Details
Collagen XVII (COL17A1) Rabbit Polyclonal Antibody
TA368022 100 µL

Collagen XVII (COL17A1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details