AKAP12 Peptide - middle region
AKAP12 Peptide - middle region
Product Specifications
Product Name Alternative
SSeCKS, AKAP250
UniProt
Q02952
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AKAP12 Rabbit Polyclonal Antibody (orb589716) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_005091.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MLSSQERMKVQGSPLKKLFTSTGLKKLSGKKQKGKRGGGDEESGEHTQVP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC943166-100 1x 100 µL
Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3/3166R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![SH3BGRL Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8F7]](https://cdn.genprice.uk/products/937/68dd1b82061270361ea1f0b6/imageurl/ta809727bm.webp)
TA809727BM 100 µL
SH3BGRL Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8F7]
Sign In for Pricing
View Details 