Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLRB1 Peptide - N-terminal region

KLRB1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NKR, CD161, CLEC5B, NKR-P1, NKRP1A, NKR-P1A, hNKR-P1A

UniProt

Q12918

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLRB1 Rabbit Polyclonal Antibody (orb589760) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002249.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IYAELNLPTDSGPESSSPSSLPRDVCQGSPWHQFALKLSCAGIILLVLVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), Biotin conjugate, 0.1mg/mL
BNCB1540-500 1x 500 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2445), CF640R conjugate, 0.1mg/mL
BNC402445-100 1x 100 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2445), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS700764 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Frozen Tissue Sections, Ileum
CS508814 5x 5 µm

Frozen Tissue Sections, Ileum

Sign In for Pricing
View Details
HCG-beta (Pregnancy & Choriocarcinoma Marker) (HCGb/1996R), CF640R conjugate, 0.1mg/mL
BNC401996-500 1x 500 µL

HCG-beta (Pregnancy & Choriocarcinoma Marker) (HCGb/1996R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Erythropoietin (EPO) (Marker of Placentation Disorders) (EPO/3793R), CF740 conjugate, 0.1mg/mL
BNC743793-100 1x 100 µL

Erythropoietin (EPO) (Marker of Placentation Disorders) (EPO/3793R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details