SEC24A Peptide - N-terminal region
SEC24A Peptide - N-terminal region
Product Specifications
UniProt
O95486
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SEC24A Rabbit Polyclonal Antibody (orb590023) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001239160.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YPHPIPAKTLNPVSGQSNYGGSQGSGQTLNRPPVASNPVTPSLHSGPAPR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1104809-01 0.02 mg (E-Coli)
Recombinant Bacillus weihenstephanensis Heptaprenylglyceryl phosphate synthase (pcrB)
Sign In for Pricing
View Details MBS1104809-02 0.1 mg (E-Coli)
Recombinant Bacillus weihenstephanensis Heptaprenylglyceryl phosphate synthase (pcrB)
Sign In for Pricing
View Details MBS1104809-03 0.02 mg (Yeast)
Recombinant Bacillus weihenstephanensis Heptaprenylglyceryl phosphate synthase (pcrB)
Sign In for Pricing
View Details MBS1104809-04 0.1 mg (Yeast)
Recombinant Bacillus weihenstephanensis Heptaprenylglyceryl phosphate synthase (pcrB)
Sign In for Pricing
View Details MBS1104809-05 0.02 mg (Baculovirus)
Recombinant Bacillus weihenstephanensis Heptaprenylglyceryl phosphate synthase (pcrB)
Sign In for Pricing
View Details MBS1104809-06 0.02 mg (Mammalian-Cell)
Recombinant Bacillus weihenstephanensis Heptaprenylglyceryl phosphate synthase (pcrB)
Sign In for Pricing
View Details