Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMPD2 Peptide - middle region

AMPD2 Peptide - middle region

Product Specifications

Product Name Alternative

PCH9, SPG63

UniProt

Q01433

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMPD2 Rabbit Polyclonal Antibody (orb590033) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001244289.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTI

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CPN1 (NM_001308) AAV Particle
RC206606A1V 250 µL

Human CPN1 (NM_001308) AAV Particle

Sign In for Pricing
View Details
NATtrol Adenovirus Type 03 Stock (Qualitative)
NATADV3-ST 1 mL

NATtrol Adenovirus Type 03 Stock (Qualitative)

Sign In for Pricing
View Details
H2BFXP sgRNA CRISPR Lentivector (Human) (Target 2)
K0926203 1.0 µg DNA

H2BFXP sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human Apolipoprotein E, Apo-E ELISA Kit
CK-bio-10480-01 48 Tests

Human Apolipoprotein E, Apo-E ELISA Kit

Sign In for Pricing
View Details
Human Apolipoprotein E, Apo-E ELISA Kit
CK-bio-10480-02 96 Tests

Human Apolipoprotein E, Apo-E ELISA Kit

Sign In for Pricing
View Details
Human Apolipoprotein E, Apo-E ELISA Kit
CK-bio-10480-03 5x 96 Tests

Human Apolipoprotein E, Apo-E ELISA Kit

Sign In for Pricing
View Details