What is the catalog number for TMEM70 Peptide - C-terminal region?

The catalog number for TMEM70 Peptide - C-terminal region is orb1999896.

What sizes are available for TMEM70 Peptide - C-terminal region?

TMEM70 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is TMEM70 Peptide - C-terminal region in stock?

TMEM70 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

TMEM70 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MC5DN2

UniProt

Q9BUB7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001035703.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TA815944S 30 µL

GRP78 (HSPA5) Mouse Monoclonal Antibody [Clone ID: OTI16C9]

Sign In for Pricing

View Details

abx178755-01 200 µg

Tumor Necrosis Factor Alpha Induced Protein 2 (TNFaIP2) Antibody

Sign In for Pricing

View Details

abx178755-02 1 mg

Tumor Necrosis Factor Alpha Induced Protein 2 (TNFaIP2) Antibody

Sign In for Pricing

View Details

TA503870 100 µL

CENPH Mouse Monoclonal Antibody [Clone ID: OTI4G6]

Sign In for Pricing

View Details

TS405718P5 25 Slides

RRM2 CytoSection

Sign In for Pricing

View Details

orb787570 2 mg

DJ1A Antibody

Sign In for Pricing

View Details