Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGAV Peptide - C-terminal region

ITGAV Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD51, MSK8, VNRA, VTNR

UniProt

P06756

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138471.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSE

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PRKRIP1 shRNA (UAS) - Lentiviral human PRKRIP1 shRNA (UAS, iRFP) (100)
GTR15156243 1 Vial

Lentiviral human PRKRIP1 shRNA (UAS) - Lentiviral human PRKRIP1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
C17orf81 (ELP5) (NM_203413) Human Over-expression Lysate
E45H16590-2 20 µg

C17orf81 (ELP5) (NM_203413) Human Over-expression Lysate

Sign In for Pricing
View Details
CDC123 (Cell Division Cycle Protein 123 Homolog, Protein D123, HT-1080, PZ32, C10orf7, D123, FLJ13863) (FITC)
124064-FITC 100 µL

CDC123 (Cell Division Cycle Protein 123 Homolog, Protein D123, HT-1080, PZ32, C10orf7, D123, FLJ13863) (FITC)

Sign In for Pricing
View Details
FLNA (filamin A, alpha (Actin Binding Protein 280), ABP-280, ABPX, DKFZp434P031, FLN, FLN1, FMD, MNS, NHBP, OPD, OPD1, OPD2) (PE)
246213-PE 100 µL

FLNA (filamin A, alpha (Actin Binding Protein 280), ABP-280, ABPX, DKFZp434P031, FLN, FLN1, FMD, MNS, NHBP, OPD, OPD1, OPD2) (PE)

Sign In for Pricing
View Details
Anti-Human CD301/CLEC10A Antibody (49C11), PerCP
HV834147-01 1 Each

Anti-Human CD301/CLEC10A Antibody (49C11), PerCP

Sign In for Pricing
View Details
Anti-Human CD301/CLEC10A Antibody (49C11), PerCP
HV834147-02 100 Tests

Anti-Human CD301/CLEC10A Antibody (49C11), PerCP

Sign In for Pricing
View Details