Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGAV Peptide - C-terminal region

ITGAV Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD51, MSK8, VNRA, VTNR

UniProt

P06756

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138471.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-MET Protein, Cynomolgus, Rhesus, Recombinant (His Tag), Biotinylated
E45K54096M2-20 20 µg

C-MET Protein, Cynomolgus, Rhesus, Recombinant (His Tag), Biotinylated

Sign In for Pricing
View Details
IGHVII-51-2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV764534 1.0 µg DNA

IGHVII-51-2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
FAM176B Adenovirus (Mouse)
19846054 1.0 mL

FAM176B Adenovirus (Mouse)

Sign In for Pricing
View Details
Obp3 Protein Lysate (Rat) with C-HA Tag
32419036 100 µg

Obp3 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Recombinant Mouse Cd36, Fc-His tagged
MK0104M 10 µg

Recombinant Mouse Cd36, Fc-His tagged

Sign In for Pricing
View Details
Cattle Poxvirus Antibody (POX-Ab) ELISA Kit
SL0038Ot-01 48 Tests

Cattle Poxvirus Antibody (POX-Ab) ELISA Kit

Sign In for Pricing
View Details