Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF12 Peptide - N-terminal region

FGF12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FHF1, FGF12B

UniProt

P61328

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004104.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRPEPQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC728800 shRNA (h) Lentiviral Particles
sc-90175-V 200 µL

LOC728800 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
GIT1 Recombinant Antibody, PerCP Conjugated
bsm-61866R-PerCP 100 µL

GIT1 Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Lentiviral human MARCKSL1 shRNA (UAS) - Lentiviral human MARCKSL1 shRNA (UAS) (25)
GTR15095357 1 Vial

Lentiviral human MARCKSL1 shRNA (UAS) - Lentiviral human MARCKSL1 shRNA (UAS) (25)

Sign In for Pricing
View Details
TMTD (Tetramethylthiuram disulfide)
T0915-01 500 mg

TMTD (Tetramethylthiuram disulfide)

Sign In for Pricing
View Details
TMTD (Tetramethylthiuram disulfide)
T0915-02 1 g

TMTD (Tetramethylthiuram disulfide)

Sign In for Pricing
View Details
TMTD (Tetramethylthiuram disulfide)
T0915-03 5 g

TMTD (Tetramethylthiuram disulfide)

Sign In for Pricing
View Details