What is the catalog number for NPTX2 Peptide - middle region?

The catalog number for NPTX2 Peptide - middle region is orb1999890.

What sizes are available for NPTX2 Peptide - middle region?

NPTX2 Peptide - middle region is available in the following size(s): 100 µg.

Is NPTX2 Peptide - middle region in stock?

NPTX2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

NPTX2 Peptide - middle region

Product Specifications

Product Name Alternative

NP2, NARP, NP-II

UniProt

P47972

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002514.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDPGHVVEQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP3-14590FR 0.1 mL

Mouse Monoclonal TNF-alpha Antibody (B-F7) [DyLight 680]

Sign In for Pricing

View Details

GE100116 1 nmol

Sequencing Primer, FC-R

Sign In for Pricing

View Details

MBS3219465-01 0.1 mL

SF3A2 Antibody - N-terminal region

Sign In for Pricing

View Details

MBS3219465-02 5x 0.1 mL

SF3A2 Antibody - N-terminal region

Sign In for Pricing

View Details

303123 100 µg

APH1A, CT (Anterior Pharynx Defective 1, Anterior Pharynx Defective 1 Homolog A, APH 1A, Aph 1alpha, APH-1a, Aph-1alpha, Aph1a, APH1A gamma Secretase Subunit, APH1A_HUMAN, CGI 78, CGI78, Gamma Secretase Subunit APH 1A, Gamma Secretase Subunit APH1a, Gamma-secretase Subunit APH-1A, Likely Ortholog of C. elegans Anterior Pharynx Defective 1A, Presenilin Stabilization Factor, Presenilin-stabilization Factor, PSF)

Sign In for Pricing

View Details

E10-20337 100 µg -100 µL

TrkA Antibody

Sign In for Pricing

View Details