Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPTX2 Peptide - middle region

NPTX2 Peptide - middle region

Product Specifications

Product Name Alternative

NP2, NARP, NP-II

UniProt

P47972

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002514.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDPGHVVEQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBG1 Adenovirus (Human)
23052052 1.0 mL

HBG1 Adenovirus (Human)

Sign In for Pricing
View Details
Cavy Neurotrophin Receptor-1 ELISA Kit
MBS038953 Inquire

Cavy Neurotrophin Receptor-1 ELISA Kit

Sign In for Pricing
View Details
KLHDC8B Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-16762R-BF405 100 µL

KLHDC8B Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Bromodeoxyuridine Antibody
abx020516 100 µg

Bromodeoxyuridine Antibody

Sign In for Pricing
View Details
Alexa Fluor™ 488-Labeled Human Siglec-2 / CD22 Protein, His TagStar Staining
SI2-HA2H7-25ug 25 µg

Alexa Fluor™ 488-Labeled Human Siglec-2 / CD22 Protein, His TagStar Staining

Sign In for Pricing
View Details
Glycoprotein VI (GP6) Human Over-expression Lysate
orb1356784 100 µg

Glycoprotein VI (GP6) Human Over-expression Lysate

Sign In for Pricing
View Details