Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NVL Peptide - N-terminal region

NVL Peptide - N-terminal region

Product Specifications

UniProt

O15381

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001230075.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGEEDNEYTESYSDDDSSMEDYPDPQSANHMNSSLLSLYRKGNPDSVSNT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCPTP (PTPN2) Human Gene Knockout Kit (CRISPR)
KN402161 1 Kit

TCPTP (PTPN2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Calcipressin 1 (RCAN1) (C-term) Rabbit Polyclonal Antibody
AP13345PU-N 400 µL

Calcipressin 1 (RCAN1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PARS2 Rabbit Polyclonal Antibody
TA370217 100 µL

PARS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Rabbit IgG, Fc Specific
HAF-451-1 1 mL

Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Rabbit IgG, Fc Specific

Sign In for Pricing
View Details
CD45RB (DF-B1), CF568 conjugate, 0.1mg/mL
BNC681066-500 1x 500 µL

CD45RB (DF-B1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL1RA (IL1RN) (NM_000577) Human Recombinant Protein
TP720025 10 µg

IL1RA (IL1RN) (NM_000577) Human Recombinant Protein

Sign In for Pricing
View Details