Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NVL Peptide - N-terminal region

NVL Peptide - N-terminal region

Product Specifications

UniProt

O15381

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001230075.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGEEDNEYTESYSDDDSSMEDYPDPQSANHMNSSLLSLYRKGNPDSVSNT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Endometrium
CS518414 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
CD73 (NT5E) (NM_002526) Human Over-expression Lysate
LC419270 20 µg

CD73 (NT5E) (NM_002526) Human Over-expression Lysate

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PAb240), CF647 conjugate, 0.1mg/mL
BNC471634-100 1x 100 µL

P53 Tumor Suppressor Protein (PAb240), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (C81/2885R), CF640R conjugate, 0.1mg/mL
BNC402885-500 1x 500 µL

CD81 / TAPA-1 (C81/2885R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3731), CF640R conjugate, 0.1mg/mL
BNC403731-100 1x 100 µL

Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3731), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PmL Protein (PmL) (NM_033244) Human Recombinant Protein
TP320236M 100 µg

PmL Protein (PmL) (NM_033244) Human Recombinant Protein

Sign In for Pricing
View Details