Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNNAL1 Peptide - N-terminal region

CTNNAL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ACRP, CLLP, alpha-CATU

UniProt

Q9UBT7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001273903.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LINHKDNTKKSDKTLQAIQRVGQAVNLAVGRFVKVGEAIANENWDLKEEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL
BNC940151-100 1x 100 µL

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF488A conjugate, 0.1mg/mL
BNC880324-100 1x 100 µL

CD53 (161-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D205), CF594 conjugate, 0.1mg/mL
BNC940205-500 1x 500 µL

Complement C4d (C4D205), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF594 conjugate, 0.1mg/mL
BNC940342-500 1x 500 µL

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2137), CF594 conjugate, 0.1mg/mL
BNC942137-100 1x 100 µL

OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2137), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details