Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINF2 Peptide - C-terminal region

SERPINF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AAP, API, PLI, A2AP, ALPHA-2-PI

UniProt

P08697

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000925.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDTTGLPLFVGSVRNPNPSAPRELKEQQDSPGNKDFLQSLKGFPRGDKLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXA1, NT (HOXA1, HOX1F, Homeobox protein Hox-A1, Homeobox protein Hox-1F) (MaxLight 750)
MBS6307647-01 0.1 mL

HOXA1, NT (HOXA1, HOX1F, Homeobox protein Hox-A1, Homeobox protein Hox-1F) (MaxLight 750)

Sign In for Pricing
View Details
HOXA1, NT (HOXA1, HOX1F, Homeobox protein Hox-A1, Homeobox protein Hox-1F) (MaxLight 750)
MBS6307647-02 5x 0.1 mL

HOXA1, NT (HOXA1, HOX1F, Homeobox protein Hox-A1, Homeobox protein Hox-1F) (MaxLight 750)

Sign In for Pricing
View Details
HMGB1, Mouse
MBS8575380-01 0.005 mg

HMGB1, Mouse

Sign In for Pricing
View Details
HMGB1, Mouse
MBS8575380-02 5x 0.005 mg

HMGB1, Mouse

Sign In for Pricing
View Details
GPR143 ORF Vector (Human) (pORF)
22510011 1.0 µg DNA

GPR143 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
APBA3 Recombinant Protein (Mouse)
RP116312 100 µg

APBA3 Recombinant Protein (Mouse)

Sign In for Pricing
View Details