Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPEP1 Peptide - middle region

DPEP1 Peptide - middle region

Product Specifications

Product Name Alternative

MDP, RDP, MBD1

UniProt

P16444

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001121613.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H7]
TA506150AM 100 µL

ZFP38 (ZSCAN21) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H7]

Sign In for Pricing
View Details
2,2,2-Trifluoro-N'-(trifluoroacetyl)acetohydrazide
TRC-T842940-100MG 100 mg

2,2,2-Trifluoro-N'-(trifluoroacetyl)acetohydrazide

Sign In for Pricing
View Details
Recombinant Human SerpinA7/TBG Protein (His Tag)
PKSH031318 50 µg

Recombinant Human SerpinA7/TBG Protein (His Tag)

Sign In for Pricing
View Details
Human OSMR (Oncostatin M Receptor) CLIA Kit
E-CL-H1347-01 24 Tests

Human OSMR (Oncostatin M Receptor) CLIA Kit

Sign In for Pricing
View Details
Human OSMR (Oncostatin M Receptor) CLIA Kit
E-CL-H1347-02 48 Tests

Human OSMR (Oncostatin M Receptor) CLIA Kit

Sign In for Pricing
View Details
Human OSMR (Oncostatin M Receptor) CLIA Kit
E-CL-H1347-03 96 Tests

Human OSMR (Oncostatin M Receptor) CLIA Kit

Sign In for Pricing
View Details