ZFHX4 Peptide - N-terminal region
ZFHX4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ZFH4, ZHF4
UniProt
Q86UP3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZFHX4 Rabbit Polyclonal Antibody (orb577202) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: METCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880451-500 1x 500 µL
HER-2 / CD340 (HRB2/451), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942488-500 1x 500 µL
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042875-500 1x 500 µL
CD44 / HCAM Std. (HCAM/2875R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details