Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP3K13 Peptide - C-terminal region

MAP3K13 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LZK, MLK, MEKK13

UniProt

O43283

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAP3K13 Rabbit Polyclonal Antibody (orb577655) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004712

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPRKTRPLQKSGDDSSEEEEGEVDSEVEFPRRQRPHRCISSCQSYSTFSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AcalephFluor350 Conjugation Kit
MBS8325654-01 1 mg

AcalephFluor350 Conjugation Kit

Sign In for Pricing
View Details
AcalephFluor350 Conjugation Kit
MBS8325654-02 5 mg

AcalephFluor350 Conjugation Kit

Sign In for Pricing
View Details
AcalephFluor350 Conjugation Kit
MBS8325654-03 5x 5 mg

AcalephFluor350 Conjugation Kit

Sign In for Pricing
View Details
MGC105567 Rat siRNA Oligo Duplex (Locus ID 498873)
SR510553 1 Kit

MGC105567 Rat siRNA Oligo Duplex (Locus ID 498873)

Sign In for Pricing
View Details
Human USP45 activation kit by CRISPRa
GA113829 1 Kit

Human USP45 activation kit by CRISPRa

Sign In for Pricing
View Details
DGK-alpha Polyclonal Antibody
MBS8522312-01 0.1 mg

DGK-alpha Polyclonal Antibody

Sign In for Pricing
View Details