Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERI1 Peptide - N-terminal region

ERI1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HEXO, THEX1, 3'HEXO

UniProt

Q8IV48

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERI1 Rabbit Polyclonal Antibody (orb324941) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_699163

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKFITSSASDFSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bifunctional Purine Biosynthesis Protein PURH (ATIC) Antibody
abx214012-01 50 µL

Bifunctional Purine Biosynthesis Protein PURH (ATIC) Antibody

Sign In for Pricing
View Details
Bifunctional Purine Biosynthesis Protein PURH (ATIC) Antibody
abx214012-02 100 µL

Bifunctional Purine Biosynthesis Protein PURH (ATIC) Antibody

Sign In for Pricing
View Details
Wdr72 (NM_001033500) Mouse Tagged Lenti ORF Clone
MR214002L4 10 µg

Wdr72 (NM_001033500) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
c-Raf Antibody (phospho Tyr340/Tyr341)
GWB-CD8B96 0.05 mL

c-Raf Antibody (phospho Tyr340/Tyr341)

Sign In for Pricing
View Details
Lentiviral human TSPAN15 shRNA (UAS) - Lentiviral human TSPAN15 shRNA (UAS, RFP) (100)
GTR15300783 1 Vial

Lentiviral human TSPAN15 shRNA (UAS) - Lentiviral human TSPAN15 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
PCGF2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV620991 1.0 µg DNA

PCGF2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details