Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R1B Peptide - middle region

PPP2R1B Peptide - middle region

Product Specifications

Product Name Alternative

PR65B, PP2A-Abeta

UniProt

P30154

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001171033

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CGLFSVCYPRASNAVKAEIRQQFRSLCSDDTPMVRRAAASKLGEFAKVLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aquaporin 3 (AQP3) (NM_004925) Human Over-expression Lysate
LC401543 20 µg

Aquaporin 3 (AQP3) (NM_004925) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS500192 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
NEK2 Human Knockdown Lysate
LY300253 100 µg

NEK2 Human Knockdown Lysate

Sign In for Pricing
View Details
Glucokinase (GCK) Rabbit Polyclonal Antibody
TA369139 100 µL

Glucokinase (GCK) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3/3166R), CF568 conjugate, 0.1mg/mL
BNC683166-500 1x 500 µL

Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3/3166R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IGKC Mouse Monoclonal Antibody [Clone ID: HP6053 + L1C1]
AM50289PU-T 20 µg

IGKC Mouse Monoclonal Antibody [Clone ID: HP6053 + L1C1]

Sign In for Pricing
View Details