Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R1B Peptide - middle region

PPP2R1B Peptide - middle region

Product Specifications

Product Name Alternative

PR65B, PP2A-Abeta

UniProt

P30154

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001171033

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CGLFSVCYPRASNAVKAEIRQQFRSLCSDDTPMVRRAAASKLGEFAKVLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SUHW2 (ZNF280B) activation kit by CRISPRa
GA115427 1 Kit

Human SUHW2 (ZNF280B) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse Fas/TNFRSF6/CD95 Protein (Fc Tag)
PDMM100158-01 20 µg

Recombinant Mouse Fas/TNFRSF6/CD95 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse Fas/TNFRSF6/CD95 Protein (Fc Tag)
PDMM100158-02 100 µg

Recombinant Mouse Fas/TNFRSF6/CD95 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse Fas/TNFRSF6/CD95 Protein (Fc Tag)
PDMM100158-03 500 µg

Recombinant Mouse Fas/TNFRSF6/CD95 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse Fas/TNFRSF6/CD95 Protein (Fc Tag)
PDMM100158-04 1 mg

Recombinant Mouse Fas/TNFRSF6/CD95 Protein (Fc Tag)

Sign In for Pricing
View Details
HLA-DR (MHC II) (TAL 1B5), CF647 conjugate, 0.1mg/mL
BNC472187-100 1x 100 µL

HLA-DR (MHC II) (TAL 1B5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details