Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COLQ Peptide - middle region

COLQ Peptide - middle region

Product Specifications

Product Name Alternative

EAD, CMS5

UniProt

Q9Y215

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COLQ Rabbit Polyclonal Antibody (orb588237) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_536800.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGFPGMLGQKGEMGPKGEPGIAGHRGPTGRPGKRGKQGQKGDSGVMGPPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Visfatin 1 ELISA Kit (Ready to Use)
orb555672-01 48 Tests

Rat Visfatin 1 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Rat Visfatin 1 ELISA Kit (Ready to Use)
orb555672-02 96 Tests

Rat Visfatin 1 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
(2-bromo-4- (trifluoromethyl) phenyl) (ethyl) sulfane
PC1020783-01 250 mg

(2-bromo-4- (trifluoromethyl) phenyl) (ethyl) sulfane

Sign In for Pricing
View Details
(2-bromo-4- (trifluoromethyl) phenyl) (ethyl) sulfane
PC1020783-02 500 mg

(2-bromo-4- (trifluoromethyl) phenyl) (ethyl) sulfane

Sign In for Pricing
View Details
(2-bromo-4- (trifluoromethyl) phenyl) (ethyl) sulfane
PC1020783-03 1 g

(2-bromo-4- (trifluoromethyl) phenyl) (ethyl) sulfane

Sign In for Pricing
View Details
(2-bromo-4- (trifluoromethyl) phenyl) (ethyl) sulfane
PC1020783-04 5 g

(2-bromo-4- (trifluoromethyl) phenyl) (ethyl) sulfane

Sign In for Pricing
View Details