Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COLQ Peptide - middle region

COLQ Peptide - middle region

Product Specifications

Product Name Alternative

EAD, CMS5

UniProt

Q9Y215

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COLQ Rabbit Polyclonal Antibody (orb588237) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_536800.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGFPGMLGQKGEMGPKGEPGIAGHRGPTGRPGKRGKQGQKGDSGVMGPPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Rae-1 MAb (Clone 199205)
MAB17581-SP 25 µg

Mouse Rae-1 MAb (Clone 199205)

Sign In for Pricing
View Details
Human NUGGC Knockout A549 cell line
GTR15421709 1 Vial

Human NUGGC Knockout A549 cell line

Sign In for Pricing
View Details
TRIM24 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62671R-BF350-TR 20 µL

TRIM24 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Human PSME2 knockdown cell line
ABC-KD12332 1 Vial

Human PSME2 knockdown cell line

Sign In for Pricing
View Details
Lrrc8a Mouse Pre-designed siRNA Set A
HY-RS21148 1 Set

Lrrc8a Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
ZIM2 (NM_015363) Human Recombinant Protein
TP760272 50 µg

ZIM2 (NM_015363) Human Recombinant Protein

Sign In for Pricing
View Details