Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYC1 Peptide - middle region

CYC1 Peptide - middle region

Product Specifications

Product Name Alternative

UQCR4, MC3DN6

UniProt

P08574

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYC1 Rabbit Polyclonal Antibody (orb588241) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001907.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRA5E siRNA Oligos set (Human)
20896171 3x 5 nmol

FRA5E siRNA Oligos set (Human)

Sign In for Pricing
View Details
Anti-PPP2R5E Antibody Picoband® HRP Conjugated
A07588-2-HRP 100 µg/Vial

Anti-PPP2R5E Antibody Picoband® HRP Conjugated

Sign In for Pricing
View Details
RPH3AL, CT (RPH3AL, NOC2, Rab effector Noc2, No C2 domains protein, Rabphilin-3A-like protein) (MaxLight 750) discontinued
041185-ML750 100 µL

RPH3AL, CT (RPH3AL, NOC2, Rab effector Noc2, No C2 domains protein, Rabphilin-3A-like protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details
DYNC1I2 Polyclonal Antibody
orb1421363 100 µL

DYNC1I2 Polyclonal Antibody

Sign In for Pricing
View Details
Ontazolast
XFA43277-01 10 mg

Ontazolast

Sign In for Pricing
View Details
Ontazolast
XFA43277-02 25 mg

Ontazolast

Sign In for Pricing
View Details