CYC1 Peptide - middle region
CYC1 Peptide - middle region
Product Specifications
Product Name Alternative
UQCR4, MC3DN6
UniProt
P08574
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CYC1 Rabbit Polyclonal Antibody (orb588241) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001907.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
201-12-0501 96 Tests
Human glomerular basement membrane antibogy (GBM) ELISA Kit
Sign In for Pricing
View Details 
CHC37974-01 50 mg
1- (2,3-Dihydro-1H-inden-5-ylmethyl) pyrrolidin-3-ol hydrochloride
Sign In for Pricing
View Details CHC37974-02 0.5 g
1- (2,3-Dihydro-1H-inden-5-ylmethyl) pyrrolidin-3-ol hydrochloride
Sign In for Pricing
View Details 
46221141 1x 10^6 Cells / 1.0 mL
TAX1BP3 CRISPR Knock Out 293T Cell Line (Human)
Sign In for Pricing
View Details IRBAMLPRKD1AP714200UL 200 µL
Rabbit Anti PRKD1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot) 200ul
Sign In for Pricing
View Details