Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSDME Peptide - middle region

GSDME Peptide - middle region

Product Specifications

Product Name Alternative

DFNA5, ICERE-1

UniProt

O60443

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSDME Rabbit Polyclonal Antibody (orb588244) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001120926.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FCLLRGKQGGFENKKRIDSVYLDPLVFREFAFIDMPDAAHGISSQDGPLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERN1 Knockout KYSE30 Polyclonal Cells
ARG9667 1 Million

ERN1 Knockout KYSE30 Polyclonal Cells

Sign In for Pricing
View Details
VSIG4 (NM_007268) Human 3' UTR Clone
SC207270 10 µg

VSIG4 (NM_007268) Human 3' UTR Clone

Sign In for Pricing
View Details
Recombinant Tissue Factor (TF)
MBS2010916-01 0.01 mg

Recombinant Tissue Factor (TF)

Sign In for Pricing
View Details
Recombinant Tissue Factor (TF)
MBS2010916-02 0.05 mg

Recombinant Tissue Factor (TF)

Sign In for Pricing
View Details
Recombinant Tissue Factor (TF)
MBS2010916-03 0.1 mg

Recombinant Tissue Factor (TF)

Sign In for Pricing
View Details
Recombinant Tissue Factor (TF)
MBS2010916-04 0.2 mg

Recombinant Tissue Factor (TF)

Sign In for Pricing
View Details