Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSDME Peptide - middle region

GSDME Peptide - middle region

Product Specifications

Product Name Alternative

DFNA5, ICERE-1

UniProt

O60443

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSDME Rabbit Polyclonal Antibody (orb588244) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001120926.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FCLLRGKQGGFENKKRIDSVYLDPLVFREFAFIDMPDAAHGISSQDGPLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP3B2 siRNA (Mouse)
orb1849091-01 15 nmol

AP3B2 siRNA (Mouse)

Sign In for Pricing
View Details
AP3B2 siRNA (Mouse)
orb1849091-02 30 nmol

AP3B2 siRNA (Mouse)

Sign In for Pricing
View Details
Pi043 Antibody
orb856387 2 mg

Pi043 Antibody

Sign In for Pricing
View Details
NF-L Recombinant Rabbit mAb, BF405 conjugated
orb2829666 100 µL

NF-L Recombinant Rabbit mAb, BF405 conjugated

Sign In for Pricing
View Details
ALS2CR2 Antibody Blocking peptide
orb1447070 500 µg

ALS2CR2 Antibody Blocking peptide

Sign In for Pricing
View Details
Compound NP-023455
MBS5793274 Inquire

Compound NP-023455

Sign In for Pricing
View Details