Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2D3 Peptide - C-terminal region

UBE2D3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

UBC4/5, UBCH5C, E2 (17) KB3

UniProt

P61077

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003331.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF736P11Y Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV756701 1.0 µg DNA

ZNF736P11Y Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Il17ra sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4708607 1.0 µg DNA

Il17ra sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Sheep Prominin 2 (PROM2) ELISA Kit
MBS9921724-01 48 Well

Sheep Prominin 2 (PROM2) ELISA Kit

Sign In for Pricing
View Details
Sheep Prominin 2 (PROM2) ELISA Kit
MBS9921724-02 96 Well

Sheep Prominin 2 (PROM2) ELISA Kit

Sign In for Pricing
View Details
Sheep Prominin 2 (PROM2) ELISA Kit
MBS9921724-03 5x 96 Well

Sheep Prominin 2 (PROM2) ELISA Kit

Sign In for Pricing
View Details
Sheep Prominin 2 (PROM2) ELISA Kit
MBS9921724-04 10x 96 Well

Sheep Prominin 2 (PROM2) ELISA Kit

Sign In for Pricing
View Details