DDA1 Peptide - N-terminal region
DDA1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
PCIA1, C19orf58
UniProt
Q9BW61
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_076955.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ADAKQFAAIQKEQLKQQSDELPASPDDSDNSVSESLDEFDYSVAEISRSF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LH13487V 100 µg
Dynein (DYNLL2) (NM_080677) Human Over-expression Lysate
Sign In for Pricing
View Details MBS1190933-01 0.02 mg (E-Coli)
Recombinant Borrelia burgdorferi Outer surface protein A (ospA)
Sign In for Pricing
View Details MBS1190933-02 0.1 mg (E-Coli)
Recombinant Borrelia burgdorferi Outer surface protein A (ospA)
Sign In for Pricing
View Details MBS1190933-03 0.02 mg (Yeast)
Recombinant Borrelia burgdorferi Outer surface protein A (ospA)
Sign In for Pricing
View Details MBS1190933-04 0.1 mg (Yeast)
Recombinant Borrelia burgdorferi Outer surface protein A (ospA)
Sign In for Pricing
View Details