Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE4A Peptide - C-terminal region

UBE4A Peptide - C-terminal region

Product Specifications

Product Name Alternative

E4, UFD2, UBOX2

UniProt

Q14139

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001191006.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAYARQASSQECIDVLLQYGCPDERFVLMATPNLSRRNNNRNNSSGRVPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Mouse ADAMTS-5 ELISA Kit
GR117327 96 Well

Nori® Mouse ADAMTS-5 ELISA Kit

Sign In for Pricing
View Details
CST5 Antibody, Biotin conjugated
CSB-PA006093LD01HU-01 50 μL

CST5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
CST5 Antibody, Biotin conjugated
CSB-PA006093LD01HU-02 100 µL

CST5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
T161A, NT (TMEM161A, Transmembrane protein 161A) (Azide free) (HRP)
MBS6353164-01 0.2 mL

T161A, NT (TMEM161A, Transmembrane protein 161A) (Azide free) (HRP)

Sign In for Pricing
View Details
T161A, NT (TMEM161A, Transmembrane protein 161A) (Azide free) (HRP)
MBS6353164-02 5x 0.2 mL

T161A, NT (TMEM161A, Transmembrane protein 161A) (Azide free) (HRP)

Sign In for Pricing
View Details
Canine Suppressors of cytokine signaling 1 (SOCS-1) ELISA Kit
NSL1336Ca 96 Tests

Canine Suppressors of cytokine signaling 1 (SOCS-1) ELISA Kit

Sign In for Pricing
View Details