What is the catalog number for UBE4A Peptide - C-terminal region?

The catalog number for UBE4A Peptide - C-terminal region is orb1999863.

What sizes are available for UBE4A Peptide - C-terminal region?

UBE4A Peptide - C-terminal region is available in the following size(s): 100 µg.

Is UBE4A Peptide - C-terminal region in stock?

UBE4A Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

UBE4A Peptide - C-terminal region

Product Specifications

Product Name Alternative

E4, UFD2, UBOX2

UniProt

Q14139

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001191006.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAYARQASSQECIDVLLQYGCPDERFVLMATPNLSRRNNNRNNSSGRVPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

70R-36248 0.1 mg

DDX55 antibody

Sign In for Pricing

View Details

KN418112 1 Kit

RGS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing

View Details

MBS488528-01 0.2 mg

Anti-CD11a [MHM24], Mouse IgG1, Kappa

Sign In for Pricing

View Details

MBS488528-02 5x 0.2 mg

Anti-CD11a [MHM24], Mouse IgG1, Kappa

Sign In for Pricing

View Details

MBS7105245-01 0.05 mg

DLG2 Antibody

Sign In for Pricing

View Details

MBS7105245-02 0.1 mg

DLG2 Antibody

Sign In for Pricing

View Details