Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP3B2 Peptide - C-terminal region

AP3B2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NAPTB

UniProt

Q13367

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001265440.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEFAEFIDSLFNLDSKSSSFQDLYCMVVPESPTSDYAEGPKSPSQQEILL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mptx sgRNA CRISPR Lentivector set (Rat)
K6689801 3x 1.0 µg

Mptx sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
RBFOX2 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb921011 100 µL

RBFOX2 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
VENTXP6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2610206 1.0 µg DNA

VENTXP6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Lentiviral mouse Dtnb shRNA (UAS) - Lentiviral mouse Dtnb shRNA (UAS, RFP) (100)
GTR15258300 1 Vial

Lentiviral mouse Dtnb shRNA (UAS) - Lentiviral mouse Dtnb shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
GNAS Blocking Peptide
33R-10097 100 ug

GNAS Blocking Peptide

Sign In for Pricing
View Details
BCL10 Mouse Monoclonal Antibody [Clone ID: LBI2G9]
AMM14604VCF 100 µg

BCL10 Mouse Monoclonal Antibody [Clone ID: LBI2G9]

Sign In for Pricing
View Details