Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PALMD Peptide - C-terminal region

PALMD Peptide - C-terminal region

Product Specifications

Product Name Alternative

PALML, C1orf11

UniProt

Q9NP74

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060204.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MVSLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRQDGVLAVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GST M1-1 Preimmune Control
MBS480157-01 0.1 mL

GST M1-1 Preimmune Control

Sign In for Pricing
View Details
GST M1-1 Preimmune Control
MBS480157-02 5x 0.1 mL

GST M1-1 Preimmune Control

Sign In for Pricing
View Details
SLC25A31 Antibody
orb670517-01 50 µg

SLC25A31 Antibody

Sign In for Pricing
View Details
SLC25A31 Antibody
orb670517-02 100 µg

SLC25A31 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Sdf2l1 shRNA (UAS) - Lentiviral mouse Sdf2l1 shRNA (UAS, RFP) (25)
GTR15254051 1 Vial

Lentiviral mouse Sdf2l1 shRNA (UAS) - Lentiviral mouse Sdf2l1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
MLEC Rabbit Polyclonal Antibody
MBS9515505-01 0.05 mL

MLEC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details