Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOT8 Peptide - C-terminal region

ACOT8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HTE, PTE1, PTE2, PTE-1, PTE-2, HNAACTE, hACTE-III

UniProt

O14734

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005460.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-VE-Cadherin CDH5-Antibody Picoband® Fluoro647 Conjugated
A02632-1-Fluoro647 100 µg/Vial

Anti-VE-Cadherin CDH5-Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Quick Step Rat anti-hepatitis B virus core IgG (HBc-IgG) elisa Kit
QS1815Ra-01 48 Tests

Quick Step Rat anti-hepatitis B virus core IgG (HBc-IgG) elisa Kit

Sign In for Pricing
View Details
Quick Step Rat anti-hepatitis B virus core IgG (HBc-IgG) elisa Kit
QS1815Ra-02 96 Tests

Quick Step Rat anti-hepatitis B virus core IgG (HBc-IgG) elisa Kit

Sign In for Pricing
View Details
JMJD6 (JmjC Domain-containing Protein 6, Jumonji Domain-containing Protein 6, Protein PTDSR, Jmjd6, Ptdsr)
136188 50 µg

JMJD6 (JmjC Domain-containing Protein 6, Jumonji Domain-containing Protein 6, Protein PTDSR, Jmjd6, Ptdsr)

Sign In for Pricing
View Details
Irf7 (NM_016850) Mouse Tagged Lenti ORF Clone
MR225814L3 10 µg

Irf7 (NM_016850) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FAM108B1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0741005 3x 1.0 µg

FAM108B1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details